Iright
BRAND / VENDOR: Proteintech

Proteintech, 12009-1-AP, CAMP Polyclonal antibody

CATALOG NUMBER: 12009-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CAMP (12009-1-AP) by Proteintech is a Polyclonal antibody targeting CAMP in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 12009-1-AP targets CAMP in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human plasma, mouse spleen tissue Positive IHC detected in: mouse spleen tissue, human lung cancer tissue, human spleen tissue, human tonsillitis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat liver tissue, mouse liver tissue Positive IF/ICC detected in: HeLa cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2622 Product name: Recombinant human CAMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC055089 Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Predict reactive species Full Name: cathelicidin antimicrobial peptide Calculated Molecular Weight: 170 aa, 19 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC055089 Gene Symbol: CAMP Gene ID (NCBI): 820 RRID: AB_908736 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49913 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924