Iright
BRAND / VENDOR: Proteintech

Proteintech, 12023-2-AP, NUCKS1 Polyclonal antibody

CATALOG NUMBER: 12023-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NUCKS1 (12023-2-AP) by Proteintech is a Polyclonal antibody targeting NUCKS1 in WB, IP, IHC, ELISA applications with reactivity to human, rat samples 12023-2-AP targets NUCKS1 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells, HEK-293 cells, MCF-7 cells, SW 1990 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human gliomas tissue, rat pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 (NUCKS1) is a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated by CDK1 and casein kinase during mitosis of the cell cycle. Phosphorylated upon DNA damage, probably by ATM or ATR. Widelyexpressed, with highest levels in thyroid gland, prostate and uterus and in fetal liver, thymus and lung. Two isoforms of NUCKS1 exist due to alternative splicing events. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2652 Product name: Recombinant human NUCKS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-243 aa of BC000805 Sequence: MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED Predict reactive species Full Name: nuclear casein kinase and cyclin-dependent kinase substrate 1 Calculated Molecular Weight: 243 aa, 27 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC000805 Gene Symbol: NUCKS1 Gene ID (NCBI): 64710 RRID: AB_906407 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H1E3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924