Iright
BRAND / VENDOR: Proteintech

Proteintech, 12035-1-AP, KIF12 Polyclonal antibody

CATALOG NUMBER: 12035-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KIF12 (12035-1-AP) by Proteintech is a Polyclonal antibody targeting KIF12 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12035-1-AP targets KIF12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, Y79 cells, mouse pancreas tissue, rat kidney tissue, mouse heart tissue Positive IHC detected in: human kidney tissue, human pancreas cancer tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information KIF12(kinesin family member 12) is a member of the kinesin superfamily (KIF), which is a microtubule-dependent ATP-driven molecular motor, and its core is involved in the regulation of organelle transport, cell division and metabolic enzyme degradation. Its functional defects are closely related to bile duct diseases, liver diseases and tumors. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2707 Product name: Recombinant human KIF12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-334 aa of BC010626 Sequence: MQRTFAWLLDRVQHLGAPVTLRASYLEIYNEQVRDLLSLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAHTLNQASSRSHALLTLYISRQTAQQMPSVDPGEPPVGGKLCFVDLAGSEKVAATGSRGELMLEANSINRSLLALGHCISLLLDPQRKQSHIPFRDSKLTKLLADSLGGRGVTLMVACVSPSAQCLPETLSTLRYASRAQRVTTRPQAPKSPVAKQPQRLETEMLQLQEENRRLQFQLDQMDCKASGLSGARVAWAQRNLYGMLQEFMLENERLRKEKSQLQNSRDLAQNEQRILAQQVHALERRLLSA Predict reactive species Full Name: kinesin family member 12 Calculated Molecular Weight: 646 aa, 71 kDa Observed Molecular Weight: 55-70 kDa GenBank Accession Number: BC010626 Gene Symbol: KIF12 Gene ID (NCBI): 113220 RRID: AB_2280813 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96FN5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924