Proteintech, 12038-1-AP, HURP Polyclonal antibody

Size: 20ul / 150ul The HURP (12038-1-AP) by Proteintech is a Polyclonal antibody targeting HURP in WB, IF/ICC, ELISA applications with reactivity to human samples 12038-1-AP targets HURP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, HEK-293 cells, A431 cells, PC-3 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DLGAP5, also named as DAP 5 or DLG7, is a kinetochore protein that stabilizes microtubules in vicinity of chromosomes. DLG7 controls spindle dynamics, promotes interkinetochore tension and efficient kinetochore capture. DGL7 is a part of Ran-dependent complex. Expression of DGL7 is found in cancer and stem cells. DLGAP5 contributes to hepatocellular carcinoma tumorigenesis by promoting cell proliferation (PMID: 24324629). Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2667 Product name: Recombinant human HURP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 498-847 aa of BC010658 Sequence: IKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNNMNHNMNKNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILEEGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEHARHISFGGNLITFSPLQPGEF Predict reactive species Full Name: discs, large (Drosophila) homolog-associated protein 5 Calculated Molecular Weight: 846 aa, 95 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC010658 Gene Symbol: HURP Gene ID (NCBI): 9787 RRID: AB_10665363 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15398 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.