Proteintech, 12044-1-AP, PCSK7 Polyclonal antibody

Size: 20ul / 150ul The PCSK7 (12044-1-AP) by Proteintech is a Polyclonal antibody targeting PCSK7 in WB, IHC, ELISA applications with reactivity to human, mouse samples 12044-1-AP targets PCSK7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse thymus tissue Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PCSK7(Proprotein convertase subtilisin/kexin type 7) is also named as LPC, PC7, PC8, SPC7 and belongs to the peptidase S8 family. It has ubiquitous endoprotease activity within constitutive secretory pathways and capable of cleavage at the RXXX[KR]R consensus motif. The full length protein has 4 glycosylation sites and it can be N-glycosylated. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2674 Product name: Recombinant human PCSK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-381 aa of BC010696 Sequence: AGTGGPDGQGTGGPSWAVHLESLEGDGEEETLEQQADALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAVLAGHEAVRWHSEQRLLRRAKRSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVPNNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGPHQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRMPFYAEECASMLAVTFSGGDKM Predict reactive species Full Name: proprotein convertase subtilisin/kexin type 7 Calculated Molecular Weight: 785 aa, 86 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC010696 Gene Symbol: PCSK7 Gene ID (NCBI): 9159 RRID: AB_2877820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16549 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.