Proteintech, 12055-2-AP, RTN3 Polyclonal antibody

Size: 20ul / 150ul The RTN3 (12055-2-AP) by Proteintech is a Polyclonal antibody targeting RTN3 in WB, IP, ELISA applications with reactivity to human samples 12055-2-AP targets RTN3 in WB, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, human brain tissue, HeLa cells, U-87 MG cells, U2OS cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). Four mammalian reticulons (RTN1-4) exist. Reticulon3 (RTN3) is highly expressed in neurons. RTN3 has been shown to modulate secretory pathway protein trafficking. It is a negative modulator of BACE1 (β-secretase) proteolytic activity. RTN3 may induce caspase-8 cascade and apoptosis and may favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, monkey, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2685 Product name: Recombinant human RTN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC011394 Sequence: MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE Predict reactive species Full Name: reticulon 3 Calculated Molecular Weight: 113 kDa Observed Molecular Weight: 24 kDa, 100-113 kDa GenBank Accession Number: BC011394 Gene Symbol: RTN3 Gene ID (NCBI): 10313 RRID: AB_2301357 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95197 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.