Iright
BRAND / VENDOR: Proteintech

Proteintech, 12056-1-AP, BRF2 Polyclonal antibody

CATALOG NUMBER: 12056-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BRF2 (12056-1-AP) by Proteintech is a Polyclonal antibody targeting BRF2 in WB, ELISA applications with reactivity to human, mouse, rat samples 12056-1-AP targets BRF2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-1080 cells, DU 145 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Human cells contain two types of RNA polymerase III transcription factor(TFIIIB), BRF1 and BRF2. BRF2,also named as BRFU, contains one TFIIB-type zinc finger. It is a general activator of RNA polymerase III transcription. It is a factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites.BRF2 is recruited to type 3 promoters such as the human U6 snRNA promoter. It differs from BRF1-TFIIIB in that it contains the TFIIB-related factor BRF2 iinstead of BRF1 and its three components do not form a stable complex. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human BRF2. It recognizes a 50-60kd band in WB analysis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2686 Product name: Recombinant human BRF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-419 aa of BC010648 Sequence: CCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP Predict reactive species Full Name: BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC010648 Gene Symbol: BRF2 Gene ID (NCBI): 55290 RRID: AB_2218683 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HAW0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924