Iright
BRAND / VENDOR: Proteintech

Proteintech, 12062-1-AP, MLLT11 Polyclonal antibody

CATALOG NUMBER: 12062-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MLLT11 (12062-1-AP) by Proteintech is a Polyclonal antibody targeting MLLT11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12062-1-AP targets MLLT11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, MOLT-4 cells, SK-N-SH cells Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Mixed-lineage leukemia translocated to 11 (MLLT11), also named ALL1-fused gene from the chromosome 1q (AF1q), which is located in chromosome l band 1q21, has been found to be overexpressed in ovarian cancer and to be associated with a poor patient outcome (PMID: 28423573). It is reported that MLLT11 is a pan-neuronal marker, suggesting a role in neural differentiation in the central nervous system and neural crest-cell derived peripheral ganglia (PMID: 24839873). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2699 Product name: Recombinant human MLLT11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC009624 Sequence: MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL Predict reactive species Full Name: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 Calculated Molecular Weight: 90 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC009624 Gene Symbol: MLLT11 Gene ID (NCBI): 10962 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13015 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924