Iright
BRAND / VENDOR: Proteintech

Proteintech, 12066-1-AP, OTUB2 Polyclonal antibody

CATALOG NUMBER: 12066-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The OTUB2 (12066-1-AP) by Proteintech is a Polyclonal antibody targeting OTUB2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12066-1-AP targets OTUB2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information OTUB2, also known as C14orf137, belongs to the OTU family. OTUB2 is a functional cysteine protease with deubiquitinase activity. OTUB2 mediates the deubiquitination of substrate proteins, and the targets of substrate proteins can be diversified. Therefore, OTUB2 has a wide range of biological roles, including protecting against virus-induced activation of interferon regulatory factor 3 (IRF3) and NF-κB, promoting beta cell survival in human pancreatic islets, and supporting the DNA repair pathway (PMID: 30662561, 35309903). OTUB2 is widely expressed, with high expression levels in the brain. OTUB2 has 2 isoforms with molecular weights of 9 kDa and 27 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2703 Product name: Recombinant human OTUB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC009615 Sequence: MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFK Predict reactive species Full Name: OTU domain, ubiquitin aldehyde binding 2 Calculated Molecular Weight: 234 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC009615 Gene Symbol: OTUB2 Gene ID (NCBI): 78990 RRID: AB_3085388 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96DC9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924