Iright
BRAND / VENDOR: Proteintech

Proteintech, 12092-1-AP, FKBP7 Polyclonal antibody

CATALOG NUMBER: 12092-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FKBP7 (12092-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP7 in WB, IHC, ELISA applications with reactivity to human samples 12092-1-AP targets FKBP7 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human lung tissue, human heart tissue Positive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FKBP7(FK506-binding protein 7) is also named as FKBP23 and belongs to immunophilin class of proteins family. This protein contains an N-terminal hydrophobic signal sequence, a PPIase motif, 2 EF-hand domains, and 2 putative N-glycosylation sites. The calculated molecular mass is about 25 kD, but becomes 33 kD following cleavage of the signal sequence(PMID:9806833). It could bind to BiP in ER in a process regulated by the concentration of Ca2+(PMID:22269648). It has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2733 Product name: Recombinant human FKBP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC009711 Sequence: MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL Predict reactive species Full Name: FK506 binding protein 7 Calculated Molecular Weight: 259 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC009711 Gene Symbol: FKBP7 Gene ID (NCBI): 51661 RRID: AB_2103418 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y680 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924