Iright
BRAND / VENDOR: Proteintech

Proteintech, 12095-1-AP, GOSR2/Membrin Polyclonal antibody

CATALOG NUMBER: 12095-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GOSR2/Membrin (12095-1-AP) by Proteintech is a Polyclonal antibody targeting GOSR2/Membrin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12095-1-AP targets GOSR2/Membrin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, human liver tissue, mouse liver tissue, mouse stomach tissue, L02 cells, rat liver tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Golgi SNAP receptor complex member 2 (GOSR2), also known as GS27 or Membrin, is a member of the solube NSF attachment protein receptor (SNARE) family of vesicle docking proteins. GOSR2 is localized in Golgi apparatus. It is involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2736 Product name: Recombinant human GOSR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC009710 Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF Predict reactive species Full Name: golgi SNAP receptor complex member 2 Calculated Molecular Weight: 212 aa, 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC009710 Gene Symbol: Membrin Gene ID (NCBI): 9570 RRID: AB_2113610 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14653 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924