Proteintech, 12096-1-AP, DNAJC19 Polyclonal antibody

Size: 20ul / 150ul The DNAJC19 (12096-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC19 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12096-1-AP targets DNAJC19 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, human lung tissue Positive IP detected in: mouse heart tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DNAJC19 is a mitochondrial cochaperone that interacts with HSP70 chaperones through its conserved J-domain. As a transmembrane protein, DNAJC19 is strongly associated with the inner mitochondrial membrane. Mutations in DNAJC19 cause dilated cardiomyopathy with ataxia (DCMA). Recently DNAJC19 has been reported as interactor of PHB complex to regulate cardiolipin remodeling, which addressed the link of DNAJC19 to cardiomyopathy. This antibody is specific to DNAJC19 and had been tested by siRNA.(24856930) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2739 Product name: Recombinant human DNAJC19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC009702 Sequence: MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 19 Calculated Molecular Weight: 116 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC009702 Gene Symbol: DNAJC19 Gene ID (NCBI): 131118 RRID: AB_2094914 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96DA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.