Proteintech, 12107-1-AP, BCOR Polyclonal antibody

Size: 20ul / 150ul The BCOR (12107-1-AP) by Proteintech is a Polyclonal antibody targeting BCOR in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 12107-1-AP targets BCOR in WB, IHC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BCOR, a corepressor of BCL6, binds to transcriptional factors and specifically inhibits gene expression. BCOR plays a key role in the early embryonic development, mesenchymal stem cell function and hematopiesis. BCOR can associate with HDACs, the polycomb group protein, polycomb group Ring finger protein1/nervous system polycomb1 (PCGF1/NSPC1), histone demethylase, F-box- and leucine-rich repeat protein10(FBXL10). Via repression of TFAP2A acts as a negative regulator of osteo-dentiogenic capacity in adult stem Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2752 Product name: Recombinant human BCOR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-361 aa of BC009675 Sequence: RFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLASDNYW Predict reactive species Full Name: BCL6 co-repressor Calculated Molecular Weight: 1703 aa, 186 kDa Observed Molecular Weight: 186 kDa GenBank Accession Number: BC009675 Gene Symbol: BCOR Gene ID (NCBI): 54880 RRID: AB_2290335 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6W2J9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.