Iright
BRAND / VENDOR: Proteintech

Proteintech, 12119-1-AP, LRDD Polyclonal antibody

CATALOG NUMBER: 12119-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LRDD (12119-1-AP) by Proteintech is a Polyclonal antibody targeting LRDD in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12119-1-AP targets LRDD in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, L02 cells Positive IP detected in: L02 cells Positive IHC detected in: human lung tissue, human pancreas tissue, human liver tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information P53-induced protein with a death domain (PIDD/LRDD) is a component of the PIDDosome. PIDD contains 910 residues with 7 leucine rich repeats (LRRs), 2 ZU-5 domains and a C-terminal death domain (DD). PIDD can be cleaved into shorter fragments generating a PIDD-N fragment of 48 kD (residues 1-446), a PIDD-C fragment of 51 kD (residues 447-910) and a PIDD-CC fragment of 37 kD (residues 589-910). Auto-cleavage of PIDD determines the downstream signaling events. The PIDD-C fragment mediates activation of NFκB via the recruitment of RIP1 and NEMO, while PIDD-CC causes caspase-2 activation, which leads to apoptosis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2761 Product name: Recombinant human LRDD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC014904 Sequence: MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAGLSGLAHLAHLDLSFNSLETLPACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPRGCSVTLACGVRLQFPAGAT Predict reactive species Full Name: leucine-rich repeats and death domain containing Calculated Molecular Weight: 893 aa, 98 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC014904 Gene Symbol: LRDD Gene ID (NCBI): 55367 RRID: AB_10694424 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HB75 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924