Iright
BRAND / VENDOR: Proteintech

Proteintech, 12124-2-AP, WSB2 Polyclonal antibody

CATALOG NUMBER: 12124-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The WSB2 (12124-2-AP) by Proteintech is a Polyclonal antibody targeting WSB2 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12124-2-AP targets WSB2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, rat kidney tissue, mouse kidney tissue, human brain tissue Positive IP detected in: mouse kidney tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information WSB2, also named SBA2, encodes WD repeat and SOCS box-containing protein 2. WSB2 may be a substrate-recognition component of an E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. WSB2 is a novel protein supposed to be involved in male- and female-specific gonadal development, and also a regulator of IL-21 receptor expression and IL21-induced signal transduction. WSB2 might be a promising novel biomarker of cell differentiation in colorectal cancer and its biological functions need further studies. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2768 Product name: Recombinant human WSB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-404 aa of BC015887 Sequence: MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF Predict reactive species Full Name: WD repeat and SOCS box-containing 2 Calculated Molecular Weight: 404 aa, 45 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC015887 Gene Symbol: WSB2 Gene ID (NCBI): 55884 RRID: AB_2216206 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYS7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924