Proteintech, 12127-1-AP, PHF21A Polyclonal antibody

Size: 20ul / 150ul The PHF21A (12127-1-AP) by Proteintech is a Polyclonal antibody targeting PHF21A in WB, ELISA applications with reactivity to human, mouse, rat samples 12127-1-AP targets PHF21A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2771 Product name: Recombinant human PHF21A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-680 aa of BC015714 Sequence: QTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRGRPPKYNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTDGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIPWPGTLAIVHSYIAYKAAKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQGEETK Predict reactive species Full Name: PHD finger protein 21A Calculated Molecular Weight: 680 aa, 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC015714 Gene Symbol: PHF21A Gene ID (NCBI): 51317 RRID: AB_2299704 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.