Iright
BRAND / VENDOR: Proteintech

Proteintech, 12170-1-AP, RTF1 Polyclonal antibody

CATALOG NUMBER: 12170-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RTF1 (12170-1-AP) by Proteintech is a Polyclonal antibody targeting RTF1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12170-1-AP targets RTF1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Calu-1 cells, HL-60 cells, mouse brain tissue, rat brain tissue, HeLa cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RTF1 (RNA polymerase-associated protein RTF1 homolog) is a multifunctional component of the Paf1 complex that regulates gene expression by directing cotranscriptional histone modification (PMID: 17576814). RTF1 is essential for global methylation of H3-Lys4 and H3-Lys79, but not H3-Lys36 (PMID: 12876293). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2812 Product name: Recombinant human RTF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-307 aa of BC015052 Sequence: MKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHDGYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKKKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGN Predict reactive species Full Name: Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) Calculated Molecular Weight: 585aa,67 kDa; 710aa,80 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC015052 Gene Symbol: RTF1 Gene ID (NCBI): 23168 RRID: AB_2180931 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92541 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924