Iright
BRAND / VENDOR: Proteintech

Proteintech, 12191-1-AP, Endothelin 1 Polyclonal antibody

CATALOG NUMBER: 12191-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Endothelin 1 (12191-1-AP) by Proteintech is a Polyclonal antibody targeting Endothelin 1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 12191-1-AP targets Endothelin 1 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells Positive IHC detected in: mouse lung tissue, mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information EDN1, also named as Endothelin-1, PPET1 and ET-1, belongs to the endothelin/sarafotoxin family. Endothelins are endothelium-derived vasoconstrictor peptides. Emerging basic science, and animal and human data all suggest that EDN1 is a potentially important contributor in the pathobiology of fibrosing disorders, including those that affect the lung(PMID:20055532 ). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2847 Product name: Recombinant human EDN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC009720 Sequence: MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW Predict reactive species Full Name: endothelin 1 Calculated Molecular Weight: 212 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC009720 Gene Symbol: Endothelin 1 Gene ID (NCBI): 1906 RRID: AB_889392 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05305 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924