Iright
BRAND / VENDOR: Proteintech

Proteintech, 12193-1-AP, ITM2B Polyclonal antibody

CATALOG NUMBER: 12193-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ITM2B (12193-1-AP) by Proteintech is a Polyclonal antibody targeting ITM2B in WB, IHC, ELISA applications with reactivity to human samples 12193-1-AP targets ITM2B in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-251 cells, fetal human brain tissue, U-251 cells unboiled Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ITM2B plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. It plays a role in the induction of neurite outgrowth and functions as a protease inhibitor by blocking access of secretases to APP cleavage sites. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2831 Product name: Recombinant human ITM2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC016148 Sequence: MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS Predict reactive species Full Name: integral membrane protein 2B Calculated Molecular Weight: 266 aa, 30 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC016148 Gene Symbol: ITM2B Gene ID (NCBI): 9445 RRID: AB_3669134 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y287 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924