Proteintech, 12198-1-AP, UCN2 Polyclonal antibody

Size: 20ul / 150ul The UCN2 (12198-1-AP) by Proteintech is a Polyclonal antibody targeting UCN2 in IHC, ELISA applications with reactivity to human samples 12198-1-AP targets UCN2 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information UCN2, also named as SRP and URP, a member of the CRF family. It is mainly expressed in skin and muscle. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2836 Product name: Recombinant human UCN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-112 aa of BC022096 Sequence: FQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC Predict reactive species Full Name: urocortin 2 Calculated Molecular Weight: 12 kDa GenBank Accession Number: BC022096 Gene Symbol: UCN2 Gene ID (NCBI): 90226 RRID: AB_2877835 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RP3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.