Iright
BRAND / VENDOR: Proteintech

Proteintech, 12211-1-AP, CPOX Polyclonal antibody

CATALOG NUMBER: 12211-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CPOX (12211-1-AP) by Proteintech is a Polyclonal antibody targeting CPOX in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 12211-1-AP targets CPOX in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, Jurkat cells, mouse liver tissue, rat liver tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CPOX(Coproporphyrinogen-III oxidase, mitochondrial) is also named as CPO and CPX. Human CPO is a 76 kDa protein that is active as a homodimer in the mitochondrial intermembrane pace(PMID:16159891).Mutations in human CPO gene predict the clinical outcome of the disease, with either hepatic hereditary coproporphyria or hematological manifestations of erythropoietic harderoporphyria.CPOX has a transit peptide of 110 aa and the chain contains 344 aa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2858 Product name: Recombinant human CPOX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC023551 Sequence: MALQLGRLSSGPCWLVARGGCGGPRAWSQCGGGGLRAWSQRSAAGRVCRPPGPAGTEQSRGLGHGSTSRGGPWVGTGLAAALAGLVGLATAAFGHVQRAEMLPKTSGTRATSLGRPEEEEDELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSVDRWERKEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYLNQEDAVHFHRTLKEA Predict reactive species Full Name: coproporphyrinogen oxidase Calculated Molecular Weight: 454 aa, 50 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC023551 Gene Symbol: CPOX Gene ID (NCBI): 1371 RRID: AB_2084233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36551 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924