Iright
BRAND / VENDOR: Proteintech

Proteintech, 12231-1-AP, CD73 Polyclonal antibody

CATALOG NUMBER: 12231-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD73 (12231-1-AP) by Proteintech is a Polyclonal antibody targeting CD73 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 12231-1-AP targets CD73 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, human spleen tissue, K-562 cells, mouse brain tissue, HT-29 cells, HuH-7 cells, Jurkat cells Positive IHC detected in: human lung cancer tissue, human stomach cancer tissue, human stomach tissue, mouse kidney tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse small intestine tissue, human appendicitis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information NT5E(5'-nucleotidase) is also named as NT5, NTE,CD73,ecto-5'-nucleotidase, and belongs to the 5'-nucleotidase family. It catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP.The enzyme occurs mainly as a dimer and the wide distribution of NT5E in the rat hippocampus, suggesting their involvement in the control of the purinergic signaling(PMID:17619139). This protein has two isoforms with the molecular weight of 63 kDa and 58 kDa and four glycosylation sites with a signalpeptide. It can exsit as a dimer(PMID:17619139). It can be detected the band of 55 kDa, 64 kDa, 70 kDa, 110 kDa by western blot(PMID:17619139; 12370277; 21533188). Defects in NT5E are the cause of calcification of joints and arteries (CALJA). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2869 Product name: Recombinant human NT5E,CD73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-264 aa of BC015940 Sequence: LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR Predict reactive species Full Name: 5'-nucleotidase, ecto (CD73) Calculated Molecular Weight: 29 kDa, 63 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC015940 Gene Symbol: CD73 Gene ID (NCBI): 4907 RRID: AB_2154081 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21589 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924