Proteintech, 12254-1-AP, POLR1D Polyclonal antibody

Size: 20ul / 150ul The POLR1D (12254-1-AP) by Proteintech is a Polyclonal antibody targeting POLR1D in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 12254-1-AP targets POLR1D in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, mouse lung tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2904 Product name: Recombinant human POLR1D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC015319 Sequence: MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR Predict reactive species Full Name: polymerase (RNA) I polypeptide D, 16kDa Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC015319 Gene Symbol: POLR1D Gene ID (NCBI): 51082 RRID: AB_10640535 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0DPB6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.