Iright
BRAND / VENDOR: Proteintech

Proteintech, 12254-1-AP, POLR1D Polyclonal antibody

CATALOG NUMBER: 12254-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The POLR1D (12254-1-AP) by Proteintech is a Polyclonal antibody targeting POLR1D in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 12254-1-AP targets POLR1D in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, mouse lung tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2904 Product name: Recombinant human POLR1D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC015319 Sequence: MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR Predict reactive species Full Name: polymerase (RNA) I polypeptide D, 16kDa Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC015319 Gene Symbol: POLR1D Gene ID (NCBI): 51082 RRID: AB_10640535 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0DPB6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924