Iright
BRAND / VENDOR: Proteintech

Proteintech, 12265-1-AP, DHX15 Polyclonal antibody

CATALOG NUMBER: 12265-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DHX15 (12265-1-AP) by Proteintech is a Polyclonal antibody targeting DHX15 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12265-1-AP targets DHX15 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells Positive IP detected in: NIH/3T3 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information DHX15, also named as DBP1 and DDX15, is a DExD/H-box protein that has been identified in spliceosome, through its carboxyl (C)-terminal G-patch domain and stimulates the helicase activity of DHX15. DHX15 is a Pre-mRNA processing factor involved in disassembly of spliceosomes after the release of mature mRNA. The MW of DHX15 is about 90-95kd. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2895 Product name: Recombinant human DHX15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 147-517 aa of BC035974 Sequence: TDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKL Predict reactive species Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 15 Calculated Molecular Weight: 795 aa, 91 kDa Observed Molecular Weight: 91 kDa GenBank Accession Number: BC035974 Gene Symbol: DHX15 Gene ID (NCBI): 1665 RRID: AB_908769 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43143 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924