Iright
BRAND / VENDOR: Proteintech

Proteintech, 12281-1-AP, LEO1 Polyclonal antibody

CATALOG NUMBER: 12281-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LEO1 (12281-1-AP) by Proteintech is a Polyclonal antibody targeting LEO1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12281-1-AP targets LEO1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, HeLa cells, HL-60 cells, human placenta tissue, Jurkat cells, mouse brain tissue, mouse skeletal muscle tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information LEO1, also named as RNA polymerase-associated protein LEO1, is a 666 amino acid protein, which belongs to the LEO1 family. LEO1 is a component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. The calculated molecular weight of LEO1 is 75 kDa, but the modified LEO1 protein is about 105 kDa (PMID: 15632063). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2932 Product name: Recombinant human LEO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC018147 Sequence: MADMEDLFGSDADSEAERKDSDSGSDSDSDQENAASGSNASGSESDQDERGDSGQPSNKELFGDDSEDEGASHHSGSDNHSERSDNRSEASERSDHEDNDPSDVDQHSGSEAPNDDEDEGHRSDGGSHHSEAEGSEKAHSDDEKWGREDKSDQSDDEKIQNSDDEERAQGSDEDKLQNSDDDEKMQNTDDEERPQLSDDERQQLSEEEKANSDDERPVASDNDDEKQNSDDEEQPQLSDEEKMQNSDDERPQASDEEHRHSDDEEEQDHKSESARGSDSEDEVLRMKRKNAIASDSEADSDTEVPKDNSGTMDLFGGADDISSGSDGEDKPP Predict reactive species Full Name: Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) Calculated Molecular Weight: 666 aa, 75 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC018147 Gene Symbol: LEO1 Gene ID (NCBI): 123169 RRID: AB_10640429 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924