Iright
BRAND / VENDOR: Proteintech

Proteintech, 12284-1-AP, PLAC8 Polyclonal antibody

CATALOG NUMBER: 12284-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PLAC8 (12284-1-AP) by Proteintech is a Polyclonal antibody targeting PLAC8 in WB, IHC, ELISA applications with reactivity to human samples 12284-1-AP targets PLAC8 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood leukocyte, PANC-1 cells Positive IHC detected in: human placenta tissue, human brain tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PLAC8, also named as Protein C15, is a placenta-specific protein. The expression was downregulated upon activation, particularly in dendritic cells generated in vitro from CD34 (142230) progenitor cells. The MW of PLAC8 is about 12-20kd. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2939 Product name: Recombinant human PLAC8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC012205 Sequence: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF Predict reactive species Full Name: placenta-specific 8 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC012205 Gene Symbol: PLAC8 Gene ID (NCBI): 51316 RRID: AB_11182285 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZF1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924