Proteintech, 12310-1-AP, HRPT2, CDC73 Polyclonal antibody

Size: 20ul / 150ul The HRPT2, CDC73 (12310-1-AP) by Proteintech is a Polyclonal antibody targeting HRPT2, CDC73 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12310-1-AP targets HRPT2, CDC73 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Positive IP detected in: mouse testis tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Parafibromin is a product of the hyperparathyroidism-jaw tumor syndrome gene HRPT2/CDC73, a putative tumor suppressor gene recently implicated in the autosomal dominant hyperparathyroidism-jaw tumor familial cancer syndrome, sporadic parathyroid cancer, and a minority of families with isolated hyperparathyroidism (PMID: 15580289). Defects in CDC73 are causes of hyperparathyroidism type 1 (HRPT1) and hyperparathyroidism type 2 (HRPT2) as well as parathyroid carcinoma (PRTC) (PMID: 12434154). Tumor suppressor parafibromin to the transcription elongation and RNA processing pathway as a PAF1 complex- and RNA polymerase II-bound protein (PMID: 15923622). Besides, parafibromin is also involved in post-transcriptional control pathways (PMID: 16116486). Recent report has revealed that pathogenic mutation, such as CDC73 gene mutation, is able to affect histone monoubiquitination (PMID: 22021426). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2959 Product name: Recombinant human HRPT2; CDC73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 109-409 aa of BC014351 Sequence: WRTRTTILQSTGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKGKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAISVTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF Predict reactive species Full Name: cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) Calculated Molecular Weight: 531 aa, 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC014351 Gene Symbol: HRPT2/CDC73 Gene ID (NCBI): 79577 RRID: AB_2078388 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P1J9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.