Iright
BRAND / VENDOR: Proteintech

Proteintech, 12315-1-AP, CRB3 Polyclonal antibody

CATALOG NUMBER: 12315-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CRB3 (12315-1-AP) by Proteintech is a Polyclonal antibody targeting CRB3 in IHC, ELISA applications with reactivity to human samples 12315-1-AP targets CRB3 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human pancreas tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Crumbs is an apical transmembrane protein crucial for epithelial morphogenesis in Drosophila melanogaster embryos. Three isoforms of mammalian Crumbs have been identified, and two have been characterized. Crumbs1 (CRB1) is expressed primarily in the central nervous system, whereas Crumbs3 (CRB3) is mainly expressed in epithelial tissues and skeletal muscles. CRB3 is an N-glycosylated, small transmembrane protein. CRB3 has a conserved cytoplasmic domain containing the two motives GTY and ERLI found in Crumbs, but exhibits a very short extracellular domain without the EGF- and laminin A-like G repeats present in the other Crumbs. Through its cytoplasmic domain and its interactors (e.g., Pals1 and Par6), CRB3 plays a role in apical membrane morphogenesis and tight junction regulation. (PMID: 14718572; 12527193; 15976445) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2968 Product name: Recombinant human CRB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-123 aa of BC018409 Sequence: PFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI Predict reactive species Full Name: crumbs homolog 3 (Drosophila) Calculated Molecular Weight: 123 aa, 13 kDa GenBank Accession Number: BC018409 Gene Symbol: CRB3 Gene ID (NCBI): 92359 RRID: AB_2877844 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924