Iright
BRAND / VENDOR: Proteintech

Proteintech, 12324-1-AP, TRIP4 Polyclonal antibody

CATALOG NUMBER: 12324-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRIP4 (12324-1-AP) by Proteintech is a Polyclonal antibody targeting TRIP4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12324-1-AP targets TRIP4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, COLO 320 cells, HeLa cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Thyroid hormone receptor interactor 4(TRIP4), other named ASC1, is a transcriptional coactivator that promote transcriptional efficiencies. It harbors an autonomous transactivation domain that contains a putative zinc finger motif, which serves as a binding site for nuclear receptors for thyroid, estrogen, all-trans-retinoic acid and RXR by interaction with SRC-1 or CBP/p300. There are two forms of ASC1 have been detected in mRNA level, isoform1(581aa, ~65kd) and isoform2(539aa,~60kd)(12077347,12390891) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2987 Product name: Recombinant human TRIP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-581 aa of BC012448 Sequence: QVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGTLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQLRIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV Predict reactive species Full Name: thyroid hormone receptor interactor 4 Calculated Molecular Weight: 581 aa, 66 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC012448 Gene Symbol: TRIP4 Gene ID (NCBI): 9325 RRID: AB_10646482 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15650 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924