Proteintech, 12326-1-AP, TIMP-4 Polyclonal antibody

Size: 20ul / 150ul The TIMP-4 (12326-1-AP) by Proteintech is a Polyclonal antibody targeting TIMP-4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 12326-1-AP targets TIMP-4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue, BxPC-3 cells, HT-1080 cells, human heart tissue Positive IHC detected in: human gliomas tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2927 Product name: Recombinant human TIMP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-224 aa of BC010553 Sequence: MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP Predict reactive species Full Name: TIMP metallopeptidase inhibitor 4 Calculated Molecular Weight: 224 aa, 26 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC010553 Gene Symbol: TIMP4 Gene ID (NCBI): 7079 RRID: AB_10638303 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99727 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.