Iright
BRAND / VENDOR: Proteintech

Proteintech, 12355-1-AP, ESM1 Polyclonal antibody

CATALOG NUMBER: 12355-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ESM1 (12355-1-AP) by Proteintech is a Polyclonal antibody targeting ESM1 in WB, IP, ELISA applications with reactivity to human samples 12355-1-AP targets ESM1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells Positive IP detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ESM1 is a secreted protein mainly expressed in the endothelial cells. The deduced 184-amino acid protein is cysteine rich with an N-terminal hydrophobic signal sequence. Expression of ESM1 was tested by Northern blot analysis and RT-PCR and was found to be constitutive in a HUVEC cell line, but not in any other cell line tested. Constitutive ESM1 expression in human tissue was restricted to lung. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3019 Product name: Recombinant human ESM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-184 aa of BC011989 Sequence: SNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR Predict reactive species Full Name: endothelial cell-specific molecule 1 Calculated Molecular Weight: 184 aa, 20 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC011989 Gene Symbol: ESM1 Gene ID (NCBI): 11082 RRID: AB_3669137 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQ30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924