Iright
BRAND / VENDOR: Proteintech

Proteintech, 12359-1-AP, SYTL2 Polyclonal antibody

CATALOG NUMBER: 12359-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SYTL2 (12359-1-AP) by Proteintech is a Polyclonal antibody targeting SYTL2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12359-1-AP targets SYTL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, MCF-7 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Synaptotagmin-like 2 (SYTL2) is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. SYTL2 contains an N-terminal Slp homology domain (SHD), Rab-binding region, and C-terminal tandem C2 domains, C2A and C2B (PMID: 11327731). It interacts with RAB27A and plays a role in promoting docking of RAB27-bound organelles to the plasma membrane (PMID: 17052176). Alternative splicing of SYTL2 gene results in multiple transcript variants encoding distinct isoforms with calculated molecular weights ranging from 39 kDa to 142 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3023 Product name: Recombinant human SYTL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-382 aa of BC015540 Sequence: MSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKGNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKMVNSPNTWIEATLPLRMLLIAKISK Predict reactive species Full Name: synaptotagmin-like 2 Calculated Molecular Weight: 934 aa, 105 kDa Observed Molecular Weight: 39 kDa, 100-105 kDa GenBank Accession Number: BC015540 Gene Symbol: SYTL2 Gene ID (NCBI): 54843 RRID: AB_11182492 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCH5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924