Iright
BRAND / VENDOR: Proteintech

Proteintech, 12364-1-AP, UQCRH Polyclonal antibody

CATALOG NUMBER: 12364-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UQCRH (12364-1-AP) by Proteintech is a Polyclonal antibody targeting UQCRH in IHC, ELISA applications with reactivity to human, mouse, rat samples 12364-1-AP targets UQCRH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UQCRH(ubiquinol-cytochrome c reductase hinge protein) belongs to the UQCRH/QCR6 family. It is a part of the mitochondrial respiratory chain that may mediate formation of the complex between cytochromes c and c1. The deduced 91-amino acid protein has a 13-amino acid N-terminal mitochondrial targeting presequence. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3037 Product name: Recombinant human UQCRH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC015177 Sequence: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK Predict reactive species Full Name: ubiquinol-cytochrome c reductase hinge protein Calculated Molecular Weight: 91 aa, 11 kDa GenBank Accession Number: BC015177 Gene Symbol: UQCRH Gene ID (NCBI): 7388 RRID: AB_2877850 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07919 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924