Iright
BRAND / VENDOR: Proteintech

Proteintech, 12376-1-AP, TALDO1 Polyclonal antibody

CATALOG NUMBER: 12376-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TALDO1 (12376-1-AP) by Proteintech is a Polyclonal antibody targeting TALDO1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 12376-1-AP targets TALDO1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, COLO 320 cells, HepG2 cells Positive IP detected in: COLO 320 cells Positive IHC detected in: human colon tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information TALDO1 belongs to the transaldolase family which contributes to the generation of NADPH in the nonoxidative phase of the pentose phosphate pathway (PPP). Defects in TALDO1 are the cause of transaldolase 1 deficiency which results in telangiectases of the skin, hepatosplenomegaly, and enlarged clitoris. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3031 Product name: Recombinant human TALDO1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-277 aa of BC009680 Sequence: MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAK Predict reactive species Full Name: transaldolase 1 Calculated Molecular Weight: 337 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC009680 Gene Symbol: TALDO1 Gene ID (NCBI): 6888 RRID: AB_2199712 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P37837 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924