Proteintech, 12381-1-AP, 14-3-3 GAMMA-Specific Polyclonal antibody

Size: 20ul / 150ul The 14-3-3 GAMMA-Specific (12381-1-AP) by Proteintech is a Polyclonal antibody targeting 14-3-3 GAMMA-Specific in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat, canine samples 12381-1-AP targets 14-3-3 GAMMA-Specific in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples. Tested Applications Positive WB detected in: mouse IMCD3 cells (RNAi), A431 cells, K-562 cells, NIH/3T3 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: MDCK cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information 14-3-3 gamma (also known as YWHAG) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody specifically recognizes gamma isoform of 14-3-3. Specification Tested Reactivity: human, mouse, rat, canine Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3047 Product name: Recombinant human 14 3 3GAMMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC020963 Sequence: MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN Predict reactive species Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide Calculated Molecular Weight: 247 aa, 28 kDa Observed Molecular Weight: 28-33 kDa GenBank Accession Number: BC020963 Gene Symbol: 14-3-3 gamma Gene ID (NCBI): 7532 RRID: AB_2217937 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61981 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.