Proteintech, 12389-1-AP, DDT Polyclonal antibody

Size: 20ul / 150ul The DDT (12389-1-AP) by Proteintech is a Polyclonal antibody targeting DDT in WB, ELISA applications with reactivity to human, mouse, rat samples 12389-1-AP targets DDT in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, HeLa cells Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3065 Product name: Recombinant human DDT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC015508 Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL Predict reactive species Full Name: D-dopachrome tautomerase Calculated Molecular Weight: 118 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC015508 Gene Symbol: DDT Gene ID (NCBI): 1652 RRID: AB_2292859 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30046 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.