Proteintech, 12390-1-AP, BEX1/2 Polyclonal antibody

Size: 20ul / 150ul The BEX1/2 (12390-1-AP) by Proteintech is a Polyclonal antibody targeting BEX1/2 in WB, IHC, ELISA applications with reactivity to human samples 12390-1-AP targets BEX1/2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue Positive IHC detected in: human medulloblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information BEX1 is a signaling adapter molecule involved in p75NTR/NGFR signaling. It lays a role in cell cycle progression and neuronal differentiation. BEX1 inhibits neuronal differentiation in response to nerve growth factor (NGF). BEX2 is a regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. It regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity. The homology between human BEX1 and BEX2 is 94%. This antibody detects both BEX1 and BEX2. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3066 Product name: Recombinant human BEX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC015522 Sequence: MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP Predict reactive species Full Name: brain expressed X-linked 2 Calculated Molecular Weight: 128 aa, 15 kDa Observed Molecular Weight: 10-15 kDa GenBank Accession Number: BC015522 Gene Symbol: BEX2 Gene ID (NCBI): 84707 RRID: AB_10644326 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXY8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.