Proteintech, 12423-1-AP, SLC20A1 Polyclonal antibody

Size: 20ul / 150ul The SLC20A1 (12423-1-AP) by Proteintech is a Polyclonal antibody targeting SLC20A1 in WB, IHC, IP, ELISA applications with reactivity to human samples 12423-1-AP targets SLC20A1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, human kidney tissue, Jurkat cells, K-562 cells, unboiled HEK-293 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human liver tissue, human breast cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC20A1 (also known as PiT1) is a high-affinity sodium-dependent phosphate (Pi) import protein. It is widely expressed and plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions. SLC20A1 is involved in cell proliferation, tumor growth and cell signaling independently of its transport function. SLC20A1 also functions as a retroviral receptor, causing human cells to be susceptible to infection by gibbon ape leukemia virus, simian sarcoma-associated virus, feline leukemia virus subgroup B, and 10A1 murine leukemia virus. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3084 Product name: Recombinant human SLC20A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-570 aa of BC019944 Sequence: FVCPRMKRKIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTSYTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKRIRMDSYTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVATPIWLLLYGGV Predict reactive species Full Name: solute carrier family 20 (phosphate transporter), member 1 Calculated Molecular Weight: 679 aa, 74 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: BC019944 Gene Symbol: SLC20A1 Gene ID (NCBI): 6574 RRID: AB_2286212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.