Proteintech, 12427-1-AP, CDC42SE1 Polyclonal antibody

Size: 20ul / 150ul The CDC42SE1 (12427-1-AP) by Proteintech is a Polyclonal antibody targeting CDC42SE1 in IHC, ELISA applications with reactivity to human samples 12427-1-AP targets CDC42SE1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CDC42SE1, also known as SPEC1, is a small effector protein of 9 kDa. CDC42SE1 consists of 79 amino acids, including a conserved CRIB domain, 2 conserved cysteines at the N-terminus, and a basic amino acid before the CRIB domain. CDC42SE1 has been shown to inhibit CDC42-induced JNK activity and cell morphological changes in COS1 cells (PMID: 23957315). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3098 Product name: Recombinant human CDC42SE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC012796 Sequence: MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL Predict reactive species Full Name: CDC42 small effector 1 Calculated Molecular Weight: 79 aa, 9 kDa GenBank Accession Number: BC012796 Gene Symbol: CDC42SE1 Gene ID (NCBI): 56882 RRID: AB_3669138 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRR8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.