Proteintech, 12452-1-AP, VPS34 (C terminal) Polyclonal antibody

Size: 20ul / 150ul The VPS34 (C terminal) (12452-1-AP) by Proteintech is a Polyclonal antibody targeting VPS34 (C terminal) in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12452-1-AP targets VPS34 (C terminal) in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, Jurkat cells, mouse brain tissue, mouse lung tissue, mouse testis tissue, rat brain tissue Positive IHC detected in: human prostate cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information PIK3C3(Phosphatidylinositol 3-kinase catalytic subunit type 3) is also named as VPS34 and belongs to the PI3/PI4-kinase family.It is a catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate which plays a key role in initiation and maturation of autophagosomes.It can form a dimer(PMID:20339072). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3110 Product name: Recombinant human PIK3C3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 600-887 aa of BC033004 Sequence: KIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK Predict reactive species Full Name: phosphoinositide-3-kinase, class 3 Calculated Molecular Weight: 887 aa, 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC033004 Gene Symbol: VPS34 Gene ID (NCBI): 5289 RRID: AB_2299709 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEB9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.