Iright
BRAND / VENDOR: Proteintech

Proteintech, 12462-1-AP, SPAG6 Polyclonal antibody

CATALOG NUMBER: 12462-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SPAG6 (12462-1-AP) by Proteintech is a Polyclonal antibody targeting SPAG6 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 12462-1-AP targets SPAG6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, Jurkat cells, PC-3 cells Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Sperm-associated antigen 6 (SPAG6) is an axonemal protein ubiquitously expressed in tissues containing ciliated cells. SPAG6 is essential for sperm motility and fertility. As a novel cancer-testis antigen, SPAG6 is overexpressed in myeloid malignancies. Recently, SPAG6 has been found to negatively regulate neuronal migration during mouse brain development. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3130 Product name: Recombinant human SPAG6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 109-458 aa of BC030585 Sequence: AVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKGIAASALSDIVKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQLSTT Predict reactive species Full Name: sperm associated antigen 6 Calculated Molecular Weight: 458 aa, 50 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC030585 Gene Symbol: SPAG6 Gene ID (NCBI): 9576 RRID: AB_2194798 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75602 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924