Iright
BRAND / VENDOR: Proteintech

Proteintech, 12478-1-AP, PREPL Polyclonal antibody

CATALOG NUMBER: 12478-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PREPL (12478-1-AP) by Proteintech is a Polyclonal antibody targeting PREPL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12478-1-AP targets PREPL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PREPL (Prolyl endopeptidase-like) is also named as KIAA0436 and belongs to the prolyl oligopeptidase subfamily of serine peptidases. IPREPL is a novel oligopeptidase with unique structural and functional characteristics (PMID:16385448). It has 4 isoforms produced by alternative splicing and can exsit as a homodimer (PMID:16143824). Defects in PREPL are a cause of hypotonia-cystinuria syndrome (HCS). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3196 Product name: Recombinant human PREPL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC013193 Sequence: MDLKMNFRPERRVLVDDGWILAYCHVRYGGELGLQWHADGRLTKKLNGLADLEACIKTLHGQGFSQPSLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF Predict reactive species Full Name: prolyl endopeptidase-like Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC013193 Gene Symbol: PREPL Gene ID (NCBI): 9581 RRID: AB_2300040 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4J6C6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924