Iright
BRAND / VENDOR: Proteintech

Proteintech, 12495-1-AP, Mu Crystallin Polyclonal antibody

CATALOG NUMBER: 12495-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Mu Crystallin (12495-1-AP) by Proteintech is a Polyclonal antibody targeting Mu Crystallin in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 12495-1-AP targets Mu Crystallin in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Y79 cells, Jurkat cells, human kidney tissue, human heart tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human gliomas tissue Positive IF/ICC detected in: SH-SY5Y cells Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information mu Crystallin(thiomorpholine-carboxylate dehydrogenase) is also named as THBP, CRYM, ketimine reductase and belongs to the ornithine cyclodeaminase family. This protein catalyzes the reduction of imine bonds in brain substrates that may include cystathionine ketimine (CysK) and lanthionine ketimine (LK). It is also involved in the regulation of the free intracellular concentration of triiodothyronine and access to its nuclear receptor. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3161 Product name: Recombinant human CRYM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-314 aa of BC018061 Sequence: MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK Predict reactive species Full Name: crystallin, mu Calculated Molecular Weight: 314 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC018061 Gene Symbol: Mu Crystallin Gene ID (NCBI): 1428 RRID: AB_2084620 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14894 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924