Proteintech, 12497-1-AP, TORC2 Polyclonal antibody

Size: 20ul / 150ul The TORC2 (12497-1-AP) by Proteintech is a Polyclonal antibody targeting TORC2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12497-1-AP targets TORC2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HEK-293 cells, mouse liver tissue, mouse kidney, rat kidney Positive IHC detected in: human skin cancer tissue, human gliomas tissue, rat kidney tissue, human urothelial carcinoma tissue, mouse lung tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CRTC2, also named as TORC2, belongs to the TORC family. It is a transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. It acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. CRTC2 enhances the interaction of CREB1 with TAF4. Ir regulates gluconeogenesis as a component of the LKB1/AMPK/TORC2 signaling pathway. CRTC2 regulates the expression of specific genes such as the steroidogenic gene, StAR. TORC2 was recently shown to be an important regulator of gluconeogenesis in the livers of mammals. It is one of the other key regulators of CRE-dependent MIE gene expression in NT2 cells. This regulation is linked to VIP-induced TORC2 dephosphorylation and translocation to the nucleus. (PMID: 19369332, 20504934 ) . Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3167 Product name: Recombinant human CRTC2,TORC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-693 aa of BC053562 Sequence: APALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ Predict reactive species Full Name: CREB regulated transcription coactivator 2 Calculated Molecular Weight: 693 aa, 73 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC053562 Gene Symbol: TORC2 Gene ID (NCBI): 200186 RRID: AB_2260910 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53ET0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.