Iright
BRAND / VENDOR: Proteintech

Proteintech, 12516-1-AP, ZBTB32 Polyclonal antibody

CATALOG NUMBER: 12516-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZBTB32 (12516-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB32 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 12516-1-AP targets ZBTB32 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat spleen tissue, pig lymph node tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The zinc finger and BTB domain containing 32 (ZBTB32) protein, also known as testis zinc finger protein (TZFP) or repressor of GATA (ROG), is a transcription factor belonging to the BTB/POZ-ZF protein family. It is encoded by the Zbtb32 gene, located on proximal chromosome 7 in the mouse genome. ZBTB32 was shown to ensure proper regulation of meiosis during spermatogenesis by acting as a repressor of the androgen receptor (PMID: 22851713, 34337361). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3199 Product name: Recombinant human ZBTB32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC017700 Sequence: MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPEQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWAEAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRRTCNLCGS Predict reactive species Full Name: zinc finger and BTB domain containing 32 Calculated Molecular Weight: 487 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC017700 Gene Symbol: ZBTB32 Gene ID (NCBI): 27033 RRID: AB_3669143 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2Y4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924