Iright
BRAND / VENDOR: Proteintech

Proteintech, 12519-1-AP, NANP Polyclonal antibody

CATALOG NUMBER: 12519-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NANP (12519-1-AP) by Proteintech is a Polyclonal antibody targeting NANP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 12519-1-AP targets NANP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, Neuro-2a cells, mouse brain tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NANP, also known as HDHD4, C20orf147, is a member of the haloacid dehalogenase family of proteins. NANP enables N-acylneuraminate-9-phosphatase activity and is involved in N-acetylneuraminate biosynthetic process. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3212 Product name: Recombinant human NANP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-248 aa of BC022552 Sequence: MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST Predict reactive species Full Name: N-acetylneuraminic acid phosphatase Calculated Molecular Weight: 248 aa, 28 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC022552 Gene Symbol: NANP Gene ID (NCBI): 140838 RRID: AB_3085396 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TBE9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924