Proteintech, 12525-1-AP, IRF2 Polyclonal antibody

Size: 20ul / 150ul The IRF2 (12525-1-AP) by Proteintech is a Polyclonal antibody targeting IRF2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12525-1-AP targets IRF2 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, COLO 320 cells, Jurkat cells, mouse colon tissue Positive IP detected in: Jurkat cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information IRF2, also known as IFN regulatory factor 2, which belongs to the IRF family. IRF2 specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the IFN consensus sequence (ICS)) and represses those genes. IRF2 also acts as an activator for several genes including H4 and IL7. IRF2 constitutively binds to the ISRE promoter to activate IL7. IRF2 is involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. The calculated molecular weight of IRF2 is 39 kDa, but post-modification of IRF2 is about 50 kDa (PMID: 17698501). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3220 Product name: Recombinant human IRF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-349 aa of BC015803 Sequence: MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC Predict reactive species Full Name: IRF 2 Calculated Molecular Weight: 349 aa, 39 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC015803 Gene Symbol: IRF2 Gene ID (NCBI): 3660 RRID: AB_2296127 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14316 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.