Proteintech, 12543-1-AP, TRIM31 Polyclonal antibody

Size: 20ul / 150ul The TRIM31 (12543-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM31 in WB, IHC, IP, ELISA applications with reactivity to human samples 12543-1-AP targets TRIM31 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells Positive IP detected in: HT-29 cells Positive IHC detected in: human small intestine tissue, Human Colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:1000 Background Information TRIM31(Tripartite motif-containing protein 31) is also named as C6orf13, RNF and belongs to the TRIM/RBCC family. The deduced protein contains an N-terminal RING domain, a B-box-2 domain, and a coiled-coil region. TRIM31 forms homodimers(PMID:11331580). This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3264 Product name: Recombinant human TRIM31 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 126-425 aa of BC017017 Sequence: HNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCKVPSS Predict reactive species Full Name: tripartite motif-containing 31 Calculated Molecular Weight: 425 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC017017 Gene Symbol: TRIM31 Gene ID (NCBI): 11074 RRID: AB_10640897 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZY9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.