Iright
BRAND / VENDOR: Proteintech

Proteintech, 12559-1-AP, STK36 Polyclonal antibody

CATALOG NUMBER: 12559-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STK36 (12559-1-AP) by Proteintech is a Polyclonal antibody targeting STK36 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 12559-1-AP targets STK36 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human prostate tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information STK36(Serine/threonine-protein kinase 36) is also named as KIAA1278 and belongs to the Ser/Thr protein kinase family. The Serine/threonine protein kinase plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors and controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization. It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3279 Product name: Recombinant human STK36 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-304 aa of BC026158 Sequence: KYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRHPNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHTADLWSVGCILYELAVGTPPFYATSIFQLVSLILKDPVRWPSTISPCFKDFLQGLLTKDPRQRLSWPDLLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSRILTQ Predict reactive species Full Name: serine/threonine kinase 36, fused homolog (Drosophila) Calculated Molecular Weight: 1315 aa, 144 kDa Observed Molecular Weight: 144 kDa GenBank Accession Number: BC026158 Gene Symbol: STK36 Gene ID (NCBI): 27148 RRID: AB_2196785 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924