Proteintech, 12561-1-AP, SELK Polyclonal antibody

Size: 20ul / 150ul The SELK (12561-1-AP) by Proteintech is a Polyclonal antibody targeting SELK in WB, ELISA applications with reactivity to human, mouse, rat samples 12561-1-AP targets SELK in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Selenoprotein K (SelK), a single-pass transmembrane protein that resides in the endoplasmic reticulum (ER) membrane, which has been reported to an emerging role of playing a part in protein palmitoylation. Human SelK is a 94-amino-acid protein with Sec residing at the penultimate position. It has been shown that SelK is expressed predominantly in the heart and skeletal muscle, but other tissues, such as the liver, pancreas, and placenta, also have detectable levels of SelK.(PMID: 36252341) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3143 Product name: Recombinant human SELK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC013162 Sequence: MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGG Predict reactive species Full Name: selenoprotein K Calculated Molecular Weight: 94 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC013162 Gene Symbol: SELK Gene ID (NCBI): 58515 RRID: AB_2186964 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6D0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.